PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G254200.1
Common NamePHAVU_003G254200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 322aa    MW: 36026.5 Da    PI: 8.823
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G254200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.56.8e-33111168260
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         ++vrY+eClkNhAa +Ggh++DGCgEfmps geegt++++kCaAC+CHRnFHR+e+e e
  Phvul.003G254200.1 111 ATVRYRECLKNHAAIMGGHVTDGCGEFMPS-GEEGTPESFKCAACECHRNFHRKEPEGE 168
                         589**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-20112164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.4E-30113165IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.4E-30114164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.417115164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.47E-17251318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-28253319IPR009057Homeodomain-like
TIGRFAMsTIGR015652.9E-25257314IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDMREQDKVI EMPGTLGYNL PNTNSSSSKL SSLIGERSDQ PPQSHTLVFS DPPQTNSHHH  60
RRLNPPNSLP PNPLQLPHPH RPRRDLDPTA ISPPIVTTSR TQPHSTGTFT ATVRYRECLK  120
NHAAIMGGHV TDGCGEFMPS GEEGTPESFK CAACECHRNF HRKEPEGESS QHVLNYHLTY  180
PNKTNRNIVI HSPQSHLQLP THHLHGVVAT PSGGSVQPAV LGFGGTPTES SSEDLNMFQT  240
DEAGQLLSVQ PPLSSSKKRF RTKFSQQQKD QMMEFADKLG WKIQKQDEQE LHQFCSQVGV  300
KRQIFKVWMH NSKQAMKKKQ M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-202563151675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156052.10.0hypothetical protein PHAVU_003G254200g
SwissprotQ9FRL57e-63ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLV7CGK10.0V7CGK1_PHAVU; Uncharacterized protein
STRINGGLYMA16G25280.21e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.13e-53homeobox protein 33